PDB entry 3h12

View 3h12 on RCSB PDB site
Description: Crystal structure of putative mandelate racemase from Bordetella Bronchiseptica RB50
Class: isomerase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, enolase, PSI-2, New York SGX Research Center for Structural Genomics, ISOMERASE
Deposited on 2009-04-10, released 2009-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mandelate racemase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WEE8 (3-388)
      • expression tag (1-2)
      • expression tag (389-392)
    Domains in SCOPe 2.07: d3h12a1, d3h12a2, d3h12a3, d3h12a4
  • Chain 'B':
    Compound: mandelate racemase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WEE8 (3-388)
      • expression tag (1-2)
      • expression tag (389-392)
    Domains in SCOPe 2.07: d3h12b1, d3h12b2, d3h12b3, d3h12b4
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h12A (A:)
    mslkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlav
    lkraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgr
    amnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprk
    daanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghri
    lraqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahla
    wnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpg
    lgfeidwdfvaahawkgepaigaghgmkkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h12A (A:)
    slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
    kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
    mnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkd
    aanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghril
    raqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahlaw
    nphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpgl
    gfeidwdfvaahawkgepaigaghgmkkeghh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h12B (B:)
    mslkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlav
    lkraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgr
    amnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprk
    daanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghri
    lraqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahla
    wnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpg
    lgfeidwdfvaahawkgepaigaghgmkkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h12B (B:)
    slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
    kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
    mnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkd
    aanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghril
    raqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahlaw
    nphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpgl
    gfeidwdfvaahawkgepaigaghgmkkeghh