PDB entry 3h10

View 3h10 on RCSB PDB site
Description: Aurora A inhibitor complex
Class: transferase
Keywords: Protein:Inhibitor complex Aurora-A, Cell cycle, Serine/threonine, protein kinase, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2009-04-10, released 2009-07-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965 (0-267)
      • engineered (0)
      • engineered (163-164)
    Domains in SCOPe 2.01: d3h10a_
  • Chain 'B':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965 (Start-267)
      • engineered (163-164)
    Domains in SCOPe 2.01: d3h10b_
  • Chain 'D':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h10d_
  • Heterogens: 97B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3h10A (A:)
    akrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrraalcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h10B (B:)
    akrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrraalcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h10B (B:)
    krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
    qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
    sychskrvihrdikpenlllgsagelkiadfgwsvhapssrraalcgtldylppemiegr
    mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
    khnpsqrpmlrevlehpwitansskps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3h10D (D:)
    akrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrraalcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h10D (D:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvhapstldylppemiegrmhdekvdlw
    slgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpm
    lrevlehpwitanss