PDB entry 3h0z

View 3h0z on RCSB PDB site
Description: Aurora A in complex with a bisanilinopyrimidine
Class: transferase
Keywords: Protein:Inhibitor complex Aurora-A, Cell cycle, Serine/threonine, protein kinase, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2009-04-10, released 2009-07-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: 0.221
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3h0za_
  • Chain 'B':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3h0zb_
  • Chain 'C':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3h0zc_
  • Heterogens: 45B

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h0zA (A:)
    akrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrraalcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h0zA (A:)
    waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqsh
    lrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
    hskrvihrdikpenlllgsagelkiadfgwstldylppemiegrmhdekvdlwslgvlcy
    eflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevleh
    pwitanss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h0zB (B:)
    akrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrraalcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h0zB (B:)
    rqwaledfeigrplgvylarekqskfilalkvlfkaqlekagvehqlrreveiqshlrhp
    nilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsychskr
    vihrdikpenlllgsagelkiadtldylppemiegrmhdekvdlwslgvlcyeflvgkpp
    feantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpwitanss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3h0zC (C:)
    akrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrraalcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h0zC (C:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadtldylppemiegrmhdekvdlwslgvlcyef
    lvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpw
    itanss