PDB entry 3h0t

View 3h0t on RCSB PDB site
Description: Hepcidin-Fab complex
Class: IMMUNE SYSTEM/Antimicrobial Protein
Keywords: Peptide-Fab complex, Antibiotic, Antimicrobial, Cleavage on pair of basic residues, Disease mutation, Disulfide bond, Fungicide, Hormone, Secreted, IMMUNE SYSTEM/Antimicrobial Protein COMPLEX
Deposited on 2009-04-10, released 2009-06-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab fragment, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3H0T (0-215)
    Domains in SCOPe 2.04: d3h0ta1, d3h0ta2
  • Chain 'B':
    Compound: Fab fragment, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3H0T (0-End)
  • Chain 'C':
    Compound: Hepcidin
    Species: Homo sapiens [TaxId:9606]
    Gene: HAMP, HEPC, hepcidin, LEAP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3h0tc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3h0tA (A:)
    nfmltqphsvsespgktvtisctrssgsiasyyvqwyqqrpgsspttviyedsqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnvvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3h0tC (C:)
    dthfpicifccgcchrskcgmcckt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h0tC (C:)
    hfpicifccgcchrskcgmcck