PDB entry 3gzp

View 3gzp on RCSB PDB site
Description: HUMAN SOD1 G93A Metal-free Variant
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, HUMAN CU, ZN SUPEROXIDE DISMUTASE, ANTIOXIDANT, METAL-BINDING, COPPER, ZINC, AMYOTROPHIC LATERAL SCLEROSIS, DISEASE MUTATION, ACETYLATION, CYTOPLASM, APO, Disulfide bond, Phosphoprotein, Ubl conjugation
Deposited on 2009-04-07, released 2009-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.205
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (92)
    Domains in SCOPe 2.07: d3gzpa_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (92)
    Domains in SCOPe 2.07: d3gzpb_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (92)
    Domains in SCOPe 2.07: d3gzpc_
  • Chain 'D':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (92)
    Domains in SCOPe 2.07: d3gzpd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gzpA (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gzpB (B:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gzpC (C:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gzpC (C:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnprhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvhekadagsrlacg
    vigiaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gzpD (D:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gzpD (D:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnprhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvhekadagsrlacg
    vigiaq