PDB entry 3gzn

View 3gzn on RCSB PDB site
Description: Structure of NEDD8-activating enzyme in complex with NEDD8 and MLN4924
Class: PROTEIN BINDING/Ligase
Keywords: NEDD8, E1-activating enzyme, MLN4924, PROTEIN BINDING-Ligase complex
Deposited on 2009-04-07, released 2010-02-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.233
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NEDD8-activating enzyme E1 regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: APPBP1, HPP1, NAE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3gzna_
  • Chain 'B':
    Compound: NEDD8-activating enzyme E1 catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: UBA3, UBE1C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3gznb_
  • Chain 'C':
    Compound: NEDD8-activating enzyme E1 regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: APPBP1, HPP1, NAE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3gznc_
  • Chain 'D':
    Compound: NEDD8-activating enzyme E1 catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: UBA3, UBE1C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3gznd_
  • Chain 'I':
    Compound: nedd8
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15843 (6-81)
      • expression tag (3-5)
    Domains in SCOPe 2.04: d3gzni_
  • Chain 'J':
    Compound: nedd8
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15843 (6-81)
      • expression tag (3-5)
    Domains in SCOPe 2.04: d3gznj_
  • Heterogens: B39, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gznA (A:)
    maqlgkllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftii
    dgnqvsgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsff
    crftvvvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnal
    edlrldkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykek
    edfrdlirqgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkq
    tpsfwilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnh
    vakllqsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpd
    neivlylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvh
    efcrygaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gznA (A:)
    lkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqvsg
    edagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftvvv
    atqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrldk
    pfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrdli
    rqgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwil
    aralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqs
    igqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlyl
    mlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcryga
    aephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gznB (B:)
    madgeepekkrrrieellaekmavdggcgdtgdwegrwnhvkkflersgpfthpdfepst
    eslqflldtckvlvigagglgcellknlalsgfrqihvidmdtidvsnlnrqflfrpkdi
    grpkaevaaeflndrvpncnvvphfnkiqdfndtfyrqfhiivcgldsiiarrwingmli
    sllnyedgvldpssivplidggtegfkgnarvilpgmtaciectlelyppqvnfpmctia
    smprlpehcieyvrmlqwpkeqpfgegvpldgddpehiqwifqkslerasqynirgvtyr
    ltqgvvkriipavastnaviaavcatevfkiatsayiplnnylvfndvdglytytfeaer
    kencpacsqlpqniqfspsaklqevldyltnsaslqmkspaitatlegknrtlylqsvts
    ieertrpnlsktlkelglvdgqelavadvttpqtvlfklhfts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gznB (B:)
    dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
    frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
    dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
    ilpgmtaciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpkeqpfgegvpldg
    ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
    tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
    aslqmkspaitatlegknrtlylqsvtsieertrpnlsklkelglvdgqelavadvttpq
    tvlfklhft
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gznC (C:)
    maqlgkllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftii
    dgnqvsgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsff
    crftvvvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnal
    edlrldkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykek
    edfrdlirqgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkq
    tpsfwilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnh
    vakllqsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpd
    neivlylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvh
    efcrygaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gznC (C:)
    llkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqvs
    gedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftvv
    vatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrld
    kpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetripktykekedfrdlir
    qgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwila
    ralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsi
    gqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylm
    lravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaa
    ephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gznD (D:)
    madgeepekkrrrieellaekmavdggcgdtgdwegrwnhvkkflersgpfthpdfepst
    eslqflldtckvlvigagglgcellknlalsgfrqihvidmdtidvsnlnrqflfrpkdi
    grpkaevaaeflndrvpncnvvphfnkiqdfndtfyrqfhiivcgldsiiarrwingmli
    sllnyedgvldpssivplidggtegfkgnarvilpgmtaciectlelyppqvnfpmctia
    smprlpehcieyvrmlqwpkeqpfgegvpldgddpehiqwifqkslerasqynirgvtyr
    ltqgvvkriipavastnaviaavcatevfkiatsayiplnnylvfndvdglytytfeaer
    kencpacsqlpqniqfspsaklqevldyltnsaslqmkspaitatlegknrtlylqsvts
    ieertrpnlsktlkelglvdgqelavadvttpqtvlfklhfts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gznD (D:)
    dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
    frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
    dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
    ilpgmtaciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpkeqpfgegvpldg
    ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
    tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
    aslqmkspaitatlegknrtlylqsvtsieertrpnlsklkelglvdgqelavadvttpq
    tvlfklhft
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3gznI (I:)
    hhhhhhmlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndek
    taadykilggsvlhlvlalrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gznI (I:)
    hhhmlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaa
    dykilggsvlhlvlalrgg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3gznJ (J:)
    hhhhhhmlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndek
    taadykilggsvlhlvlalrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gznJ (J:)
    hhhmlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaa
    dykilggsvlhlvlalrgg