PDB entry 3gz9

View 3gz9 on RCSB PDB site
Description: Crystal Structure of Peroxisome Proliferator-Activated Receptor Delta (PPARd) in Complex with a Full Agonist
Class: transcription
Keywords: PPAR, PPAR delta, transcription, nuclear receptor fold, transcription regulation, hormone, growth factor receptor, complex, Activator, Alternative splicing, DNA-binding, Metal-binding, Nucleus, Receptor, Zinc, Zinc-finger
Deposited on 2009-04-06, released 2009-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03181 (0-268)
      • engineered (100)
      • engineered (126)
    Domains in SCOPe 2.07: d3gz9a_
  • Heterogens: B7G, D32, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gz9A (A:)
    qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
    lvnglppykeisvhvfyrcqcttvetvreltefaksipsfgslflndqvtllkygvheai
    famlaslvnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
    fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
    tehaqmmqrikktetetslhpllqeiykd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gz9A (A:)
    qvadlkafskhiynaylknfnmtkkkarsiltgkaapfvihdietlwqaekglvwkglpp
    ykeisvhvfyrcqcttvetvreltefaksipsfgslflndqvtllkygvheaifamlasl
    vnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiil
    cgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmm
    qrikktetetslhpllqeiykd