PDB entry 3gxr

View 3gxr on RCSB PDB site
Description: The crystal structure of g-type lysozyme from Atlantic cod (Gadus morhua L.) in complex with NAG oligomers sheds new light on substrate binding and the catalytic mechanism. Structure with NAG to 1.7
Class: hydrolase
Keywords: Atlantic cod, fish lysozyme, active site residues, substrate binding sites, surface potential, muramidase activity, immune system, HYDROLASE
Deposited on 2009-04-02, released 2009-10-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.206
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Goose-type lysozyme 1
    Species: Gadus morhua [TaxId:8049]
    Gene: lysozyme
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9TU22 (Start-186)
      • see remark 999 (144)
    Domains in SCOPe 2.05: d3gxra_
  • Chain 'B':
    Compound: Goose-type lysozyme 1
    Species: Gadus morhua [TaxId:8049]
    Gene: lysozyme
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9TU22 (Start-186)
      • see remark 999 (144)
    Domains in SCOPe 2.05: d3gxrb_
  • Chain 'C':
    Compound: Goose-type lysozyme 1
    Species: Gadus morhua [TaxId:8049]
    Gene: lysozyme
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9TU22 (0-186)
      • see remark 999 (144)
    Domains in SCOPe 2.05: d3gxrc_
  • Chain 'D':
    Compound: Goose-type lysozyme 1
    Species: Gadus morhua [TaxId:8049]
    Gene: lysozyme
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9TU22 (Start-186)
      • see remark 999 (144)
    Domains in SCOPe 2.05: d3gxrd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gxrA (A:)
    vgygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvd
    paviaaiisresragnvifnttppgwgdnyngfglmqvdkryheprgawnseehidqatg
    ilvnfiqliqkkfpswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraq
    wykkngf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gxrA (A:)
    ygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvdpa
    viaaiisresragnvifnttppgwgdnyngfglmqvdkryheprgawnseehidqatgil
    vnfiqliqkkfpswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraqwy
    kkngf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gxrB (B:)
    vgygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvd
    paviaaiisresragnvifnttppgwgdnyngfglmqvdkryheprgawnseehidqatg
    ilvnfiqliqkkfpswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraq
    wykkngf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gxrB (B:)
    ditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvdpavi
    aaiisresragnvifnttppgwgdnyngfglmqvdkryheprgawnseehidqatgilvn
    fiqliqkkfpswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraqwykk
    ngf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gxrC (C:)
    vgygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvd
    paviaaiisresragnvifnttppgwgdnyngfglmqvdkryheprgawnseehidqatg
    ilvnfiqliqkkfpswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraq
    wykkngf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gxrC (C:)
    vgygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvd
    paviaaiisresragnyngfglmqvdkryheprgawnseehidqatgilvnfiqliqkkf
    pswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraqwykkngf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gxrD (D:)
    vgygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvd
    paviaaiisresragnvifnttppgwgdnyngfglmqvdkryheprgawnseehidqatg
    ilvnfiqliqkkfpswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraq
    wykkngf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gxrD (D:)
    gygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvdp
    aviaaiisresragnvifnttppgwgdnyngfglmqvdkryheprgawnseehidqatgi
    lvnfiqliqkkfpswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraqw
    ykkngf