PDB entry 3gxl

View 3gxl on RCSB PDB site
Description: ALK-5 kinase complex with GW857175
Class: transferase
Keywords: TGF-beta, Alk5, kinase, inhibitor, quinazoline, Aortic aneurysm, ATP-binding, Craniosynostosis, Disease mutation, Disulfide bond, Glycoprotein, Magnesium, Manganese, Membrane, Metal-binding, Nucleotide-binding, Phosphoprotein, Polymorphism, Receptor, Serine/threonine-protein kinase, Transferase, Transmembrane
Deposited on 2009-04-02, released 2009-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gxla_
  • Heterogens: QIG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gxlA (A:)
    iartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhenil
    gfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhmei
    vgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkryma
    pevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsvee
    mrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqqeg
    ikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gxlA (A:)
    iartivlqesigkgrfgevwrgkwevavkifssreerswfreaeiyqtvmlrhenilgfi
    aadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhmeivgt
    qgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidrvgtkrymapevlddsi
    nmkhfesfkradiyamglvfweiarrcsihedyqlpyydlvpsdpsveemrkvvceqklr
    pnipnrscealrvmakimrecwyangaarltalrikktlsqlsqq