PDB entry 3gwt

View 3gwt on RCSB PDB site
Description: Catalytic domain of human phosphodiesterase 4B2B in complex with a quinoline inhibitor
Class: hydrolase
Keywords: PDE, PHOSPHODIESTERASE, cAMP, Hydrolase
Deposited on 2009-04-01, released 2010-04-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.207
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4B, DPDE4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07343 (1-End)
      • engineered (331)
      • engineered (336)
    Domains in SCOPe 2.05: d3gwta_
  • Heterogens: 066, ZN, MG, ARS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gwtA (A:)
    msisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfr
    issdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifa
    aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkq
    rqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhc
    adlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyi
    vhplwetwadlvqpdaqdildtlednrnwyqamipqapappldeqnrdcqglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gwtA (A:)
    sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
    ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
    aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
    qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
    dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
    hplwetwadlvqpdaqdildtlednrnwyqamipqa