PDB entry 3gvy

View 3gvy on RCSB PDB site
Description: Crystal structure of bacterioferritin from R.sphaeroides
Class: metal binding protein
Keywords: bacterioferritin, ferritin, iron storage, di-iron, ferroxidase activity, heme, Metal binding protein
Deposited on 2009-03-31, released 2009-12-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.23
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Rhodobacter sphaeroides [TaxId:272943]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gvya_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Rhodobacter sphaeroides [TaxId:272943]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gvyb_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Rhodobacter sphaeroides [TaxId:272943]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gvyc_
  • Heterogens: HEM, FE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gvyA (A:)
    mqgdakvieylnaalrseltavsqywlhyrlqedwgfgsiahksrkesieemhhadkliq
    riiflgghpnlqrlnplrigqtlretldadlaaehdartlyieardhcekvrdypskmlf
    eeliadeeghidyletqidlmgsigeqnygmlnakpadeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gvyA (A:)
    mqgdakvieylnaalrseltavsqywlhyrlqedwgfgsiahksrkesieemhhadkliq
    riiflgghpnlqrlnplrigqtlretldadlaaehdartlyieardhcekvrdypskmlf
    eeliadeeghidyletqidlmgsigeqnygmlnakpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gvyB (B:)
    mqgdakvieylnaalrseltavsqywlhyrlqedwgfgsiahksrkesieemhhadkliq
    riiflgghpnlqrlnplrigqtlretldadlaaehdartlyieardhcekvrdypskmlf
    eeliadeeghidyletqidlmgsigeqnygmlnakpadeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gvyB (B:)
    mqgdakvieylnaalrseltavsqywlhyrlqedwgfgsiahksrkesieemhhadkliq
    riiflgghpnlqrlnplrigqtlretldadlaaehdartlyieardhcekvrdypskmlf
    eeliadeeghidyletqidlmgsigeqnygmlnakpad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gvyC (C:)
    mqgdakvieylnaalrseltavsqywlhyrlqedwgfgsiahksrkesieemhhadkliq
    riiflgghpnlqrlnplrigqtlretldadlaaehdartlyieardhcekvrdypskmlf
    eeliadeeghidyletqidlmgsigeqnygmlnakpadeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gvyC (C:)
    mqgdakvieylnaalrseltavsqywlhyrlqedwgfgsiahksrkesieemhhadkliq
    riiflgghpnlqrlnplrigqtlretldadlaaehdartlyieardhcekvrdypskmlf
    eeliadeeghidyletqidlmgsigeqnygmlnakpad