PDB entry 3gtu

View 3gtu on RCSB PDB site
Description: ligand-free heterodimeric human glutathione s-transferase m2-3 (ec 2.5.1.18), monoclinic crystal form
Deposited on 1998-07-29, released 1999-07-29
The last revision prior to the SCOP 1.61 freeze date was dated 1999-07-29, with a file datestamp of 1999-07-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gtuA (A:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gtuB (B:)
    scessmvlgywdirglahairllleftdtsyeekrytcgeapdydrsqwldvkfkldldf
    pnlpylldgknkitqsnailryiarkhnmcgeteeekirvdiienqvmdfrtqlirlcys
    sdheklkpqyleelpgqlkqfsmflgkfswfagekltfvdfltydildqnrifdpkclde
    fpnlkafmcrfealekiaaylqsdqfckmpinnkmaqwgnkpvc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gtuC (C:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gtuD (D:)
    scessmvlgywdirglahairllleftdtsyeekrytcgeapdydrsqwldvkfkldldf
    pnlpylldgknkitqsnailryiarkhnmcgeteeekirvdiienqvmdfrtqlirlcys
    sdheklkpqyleelpgqlkqfsmflgkfswfagekltfvdfltydildqnrifdpkclde
    fpnlkafmcrfealekiaaylqsdqfckmpinnkmaqwgnkpvc