PDB entry 3gtt

View 3gtt on RCSB PDB site
Description: Mouse SOD1
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, MOUSE CU, ZN SUPEROXIDE DISMUTASE, ANTIOXIDANT, METAL-BINDING, AMYOTROPHIC LATERAL SCLEROSIS, Disulfide bond, Phosphoprotein
Deposited on 2009-03-28, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.16
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Mus musculus [TaxId:10090]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gtta_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Mus musculus [TaxId:10090]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gttb_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Mus musculus [TaxId:10090]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gttc_
  • Chain 'D':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Mus musculus [TaxId:10090]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gttd_
  • Chain 'E':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Mus musculus [TaxId:10090]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gtte_
  • Chain 'F':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Mus musculus [TaxId:10090]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gttf_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gttA (A:)
    amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
    gphfnphskkhggpadeerhvgdlgnvtagkdgvanvsiedrvislsgehsiigrtmvvh
    ekqddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gttB (B:)
    amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
    gphfnphskkhggpadeerhvgdlgnvtagkdgvanvsiedrvislsgehsiigrtmvvh
    ekqddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gttC (C:)
    amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
    gphfnphskkhggpadeerhvgdlgnvtagkdgvanvsiedrvislsgehsiigrtmvvh
    ekqddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gttD (D:)
    amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
    gphfnphskkhggpadeerhvgdlgnvtagkdgvanvsiedrvislsgehsiigrtmvvh
    ekqddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gttE (E:)
    amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
    gphfnphskkhggpadeerhvgdlgnvtagkdgvanvsiedrvislsgehsiigrtmvvh
    ekqddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gttF (F:)
    amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
    gphfnphskkhggpadeerhvgdlgnvtagkdgvanvsiedrvislsgehsiigrtmvvh
    ekqddlgkggneestktgnagsrlacgvigiaq