PDB entry 3gt7

View 3gt7 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF SIGNAL RECEIVER DOMAIN OF SIGNAL TRANSDUCTION HISTIDINE KINASE FROM Syntrophus aciditrophicus
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, SIGNAL RECEIVER DOMAIN, KINASE, PSI-2, PROTEIN STRUCTURE INITIATIVE, NEW YORK SGX RESEARCH CENTER FOR STRUCTURAL GENOMICS, NYSGXRC, Phosphoprotein, Transferase, Two-component regulatory system, HYDROLASE
Deposited on 2009-03-27, released 2009-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor protein
    Species: Syntrophus aciditrophicus SB [TaxId:56780]
    Gene: SYNAS_02120, SYN_02576
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gt7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gt7A (A:)
    mslsnrageilivedsptqaehlkhileetgyqtehvrngreavrflsltrpdliisdvl
    mpemdgyalcrwlkgqpdlrtipvilltilsdprdvvrslecgaddfitkpckdvvlash
    vkrllsgvkrteerysresitlafgneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gt7A (A:)
    ageilivedsptqaehlkhileetgyqtehvrngreavrflsltrpdliisdvlmpemdg
    yalcrwlkgqpdlrtipvilltilsdprdvvrslecgaddfitkpckdvvlashvkrlls
    gvkrtesitlaf