PDB entry 3gst

View 3gst on RCSB PDB site
Description: structure of the xenobiotic substrate binding site of a glutathione s- transferase as revealed by x-ray crystallographic analysis of product complexes with the diastereomers of 9-(s-glutathionyl)-10-hydroxy-9, 10-dihydrophenanthrene
Deposited on 1993-06-07, released 1993-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.159
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gstA (A:)
    pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqwsnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gstB (B:)
    pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqwsnk