PDB entry 3grc

View 3grc on RCSB PDB site
Description: Crystal structure of a sensor protein from Polaromonas sp. JS666
Class: transferase
Keywords: Sensor protein, Kinase, Protein Structure Initiative II(PSI II), NYSGXRC, 11025b, Structural Genomics, New York SGX Research Center for Structural Genomics, Phosphoprotein, Transferase
Deposited on 2009-03-25, released 2009-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-14, with a file datestamp of 2009-04-10.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.221
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor protein, Kinase
    Species: Polaromonas sp. JS666 [TaxId:296591]
    Gene: Bpro_4825
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3grca_
  • Chain 'B':
    Compound: Sensor protein, Kinase
    Species: Polaromonas sp. JS666 [TaxId:296591]
    Gene: Bpro_4825
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3grcb_
  • Chain 'C':
    Compound: Sensor protein, Kinase
    Species: Polaromonas sp. JS666 [TaxId:296591]
    Gene: Bpro_4825
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3grcc_
  • Chain 'D':
    Compound: Sensor protein, Kinase
    Species: Polaromonas sp. JS666 [TaxId:296591]
    Gene: Bpro_4825
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3grcd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3grcA (A:)
    mslaprpriliceddpdiarllnlmlekggfdsdmvhsaaqaleqvarrpyaamtvdlnl
    pdqdgvsliralrrdsrtrdlaivvvsanaregelefnsqplavstwlekpidenllils
    lhraidnmaegkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3grcA (A:)
    prpriliceddpdiarllnlmlekggfdsdmvhsaaqaleqvarrpyaamtvdlnlpdqd
    gvsliralrrdsrtrdlaivvvsanaregelefnsqplavstwlekpidenllilslhra
    idnma
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3grcB (B:)
    mslaprpriliceddpdiarllnlmlekggfdsdmvhsaaqaleqvarrpyaamtvdlnl
    pdqdgvsliralrrdsrtrdlaivvvsanaregelefnsqplavstwlekpidenllils
    lhraidnmaegkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3grcB (B:)
    prpriliceddpdiarllnlmlekggfdsdmvhsaaqaleqvarrpyaamtvdlnlpdqd
    gvsliralrrdsrtrdlaivvvsanaregelefnsqplavstwlekpidenllilslhra
    idn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3grcC (C:)
    mslaprpriliceddpdiarllnlmlekggfdsdmvhsaaqaleqvarrpyaamtvdlnl
    pdqdgvsliralrrdsrtrdlaivvvsanaregelefnsqplavstwlekpidenllils
    lhraidnmaegkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3grcC (C:)
    prpriliceddpdiarllnlmlekggfdsdmvhsaaqaleqvarrpyaamtvdlnlpdqd
    gvsliralrrdsrtrdlaivvvsanaregelefnsqplavstwlekpidenllilslhra
    idnma
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3grcD (D:)
    mslaprpriliceddpdiarllnlmlekggfdsdmvhsaaqaleqvarrpyaamtvdlnl
    pdqdgvsliralrrdsrtrdlaivvvsanaregelefnsqplavstwlekpidenllils
    lhraidnmaegkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3grcD (D:)
    prpriliceddpdiarllnlmlekggfdsdmvhsaaqaleqvarrpyaamtvdlnlpdqd
    gvsliralrrdsrtrdlaivvvsanaregelefnsqplavstwlekpidenllilslhra
    idnma