PDB entry 3gou

View 3gou on RCSB PDB site
Description: Crystal structure of dog (Canis familiaris) hemoglobin
Class: oxygen transport
Keywords: Heme, oxygen transport, tetramer, Iron, Metal-binding, Polymorphism, Transport
Deposited on 2009-03-20, released 2009-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.205
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: CANIS FAMILIARIS [TaxId:9615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3goua_
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: CANIS FAMILIARIS [TaxId:9615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3goub_
  • Chain 'C':
    Compound: Hemoglobin subunit alpha
    Species: CANIS FAMILIARIS [TaxId:9615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gouc_
  • Chain 'D':
    Compound: Hemoglobin subunit beta
    Species: CANIS FAMILIARIS [TaxId:9615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3goud_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gouA (A:)
    vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
    kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
    vhasldkffaavstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gouB (B:)
    vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
    kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
    eftpqvqaayqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gouC (C:)
    vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
    kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
    vhasldkffaavstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gouD (D:)
    vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
    kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
    eftpqvqaayqkvvagvanalahkyh