PDB entry 3gnm

View 3gnm on RCSB PDB site
Description: The crystal structure of the JAA-F11 monoclonal antibody Fab fragment
Class: immune system
Keywords: Antibody, immunoglobulin, JAA-F11, Thompson-Friedenreich antigen, IMMUNE SYSTEM
Deposited on 2009-03-17, released 2010-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: JAA-F11 Fab Antibody Fragment, Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GNM (0-End)
  • Chain 'L':
    Compound: JAA-F11 Fab Antibody Fragment, Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GNM (0-End)
    Domains in SCOPe 2.07: d3gnml1, d3gnml2
  • Heterogens: 1PE, EDO, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3gnmL (L:)
    evlmtqtplslpvnlgdqasiscrssqtivysngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaddlgvyycfqgshvpftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlngwtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gnmL (L:)
    evlmtqtplslpvnlgdqasiscrssqtivysngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaddlgvyycfqgshvpftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlngwtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn