PDB entry 3gn8

View 3gn8 on RCSB PDB site
Description: X-ray Crystal Structure of AncGR2 in Complex with Dexamethasone
Class: hormone/hormone activator
Keywords: nuclear receptor, GR2, evolution, glucocorticoid receptor, dexamethasone, cortisol, Activator, Nucleus, Phosphoprotein, Polymorphism, Transcription, Transcription regulation, HORMONE/HORMONE ACTIVATOR COMPLEX
Deposited on 2009-03-16, released 2009-09-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GN8 (0-248)
    Domains in SCOPe 2.06: d3gn8a_
  • Chain 'B':
    Compound: Glucocorticoid receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GN8 (0-248)
    Domains in SCOPe 2.06: d3gn8b_
  • Chain 'C':
    Compound: nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DEX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gn8A (A:)
    aptlislleviepevlysgydstlpdtstrlmstlnrlggrqvvsavkwakalpgfrnlh
    lddqmtllqyswmslmafslgwrsykqsngnmlcfapdlvineermqlpymydqcqqmlk
    issefvrlqvsydeylcmkvllllstvpkdglksqavfdeirmtyikelgkaivkregns
    sqnwqrfyqltklldsmhemvggllqfcfytfvnkslsvefpemlaeiisnqlpkfkags
    vkpllfhqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gn8B (B:)
    aptlislleviepevlysgydstlpdtstrlmstlnrlggrqvvsavkwakalpgfrnlh
    lddqmtllqyswmslmafslgwrsykqsngnmlcfapdlvineermqlpymydqcqqmlk
    issefvrlqvsydeylcmkvllllstvpkdglksqavfdeirmtyikelgkaivkregns
    sqnwqrfyqltklldsmhemvggllqfcfytfvnkslsvefpemlaeiisnqlpkfkags
    vkpllfhqk
    

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    No sequence available.