PDB entry 3gn4

View 3gn4 on RCSB PDB site
Description: Myosin lever arm
Class: motor protein
Keywords: unconventional myosin, motility, lever arm, 3-helix bundle, Actin-binding, ATP-binding, Calmodulin-binding, Coiled coil, Cytoplasm, Endocytosis, Golgi apparatus, Hearing, Membrane, Motor protein, Myosin, Nucleotide-binding, Nucleus, Phosphoprotein, Protein transport, Transport, Acetylation, Calcium, MOTOR PROTEIN/METAL BINDING PROTEIN COMPLEX
Deposited on 2009-03-16, released 2009-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.211
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-VI
    Species: Sus scrofa [TaxId:9823]
    Gene: MYO6
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: calmodulin
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Cam, CG8472
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gn4b_
  • Chain 'D':
    Compound: calmodulin
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Cam, CG8472
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gn4d_
  • Chain 'E':
    Compound: Myosin-VI
    Species: Sus scrofa [TaxId:9823]
    Gene: MYO6
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: calmodulin
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Cam, CG8472
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gn4f_
  • Chain 'H':
    Compound: calmodulin
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Cam, CG8472
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gn4h_
  • Heterogens: CA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gn4B (B:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltde
    evdemireadidgdgqvnyeefvtmmtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gn4B (B:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvtmmts
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gn4D (D:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltde
    evdemireadidgdgqvnyeefvtmmtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gn4D (D:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvtmmts
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3gn4F (F:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltde
    evdemireadidgdgqvnyeefvtmmtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gn4F (F:)
    dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
    tidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeev
    demireadidgdgqvnyeefvtmmts
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3gn4H (H:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltde
    evdemireadidgdgqvnyeefvtmmtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gn4H (H:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvtmmts