PDB entry 3gmw

View 3gmw on RCSB PDB site
Description: Crystal Structure of Beta-Lactamse Inhibitory Protein-I (BLIP-I) in Complex with TEM-1 Beta-Lactamase
Class: protein binding
Keywords: protein-protein complex, Antibiotic resistance, Hydrolase, Plasmid, PROTEIN BINDING
Deposited on 2009-03-15, released 2009-03-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-lactamase
    Species: Escherichia sp. Sflu5 [TaxId:299586]
    Gene: amp, bla
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gmwa_
  • Chain 'B':
    Compound: Beta-lactamase inhibitory protein BLIP-I
    Species: Streptomyces exfoliatus [TaxId:1905]
    Gene: bliA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gmwb_
  • Chain 'C':
    Compound: B-lactamase
    Species: Escherichia sp. Sflu5 [TaxId:299586]
    Gene: amp, bla
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gmwc_
  • Chain 'D':
    Compound: Beta-lactamase inhibitory protein BLIP-I
    Species: Streptomyces exfoliatus [TaxId:1905]
    Gene: bliA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gmwd_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gmwA (A:)
    etlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvdag
    qeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggpke
    ltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrqql
    idwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttgsq
    atmdernrqiaeigaslikhw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gmwB (B:)
    sgfsaekyeqiqfgmtfdevweigggeaacdtggvigdsilcftesgdyapyggfsftde
    gelwskrneylykaktpsvklshynrtalgmteaqlwaavpkdscvsqgesypnwpaktg
    feekyycaaatglfppsasfhltdgvltyryqrslt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gmwB (B:)
    fsaekyeqiqfgmtfdevweigggeaacdtggvigdsilcftesgdyapyggfsftdege
    lwskrneylykaktpsvklshynrtalgmteaqlwaavpkdscvsqgesypnwpaktgfe
    ekyycaaatglfppsasfhltdgvltyryqrslt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gmwC (C:)
    etlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvdag
    qeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggpke
    ltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrqql
    idwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttgsq
    atmdernrqiaeigaslikhw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gmwD (D:)
    sgfsaekyeqiqfgmtfdevweigggeaacdtggvigdsilcftesgdyapyggfsftde
    gelwskrneylykaktpsvklshynrtalgmteaqlwaavpkdscvsqgesypnwpaktg
    feekyycaaatglfppsasfhltdgvltyryqrslt