PDB entry 3gm0

View 3gm0 on RCSB PDB site
Description: Anti-methamphetamine single chain Fv in complex with MDMA
Class: immune system
Keywords: anti-methamphetamine antibody, single chain Fv, Therapeutic antibody, IMMUNE SYSTEM
Deposited on 2009-03-12, released 2009-10-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.214
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-methamphetamine single chain Fv
    Species: Mus musculus [TaxId:10090]
    Gene: IgG
    Database cross-references and differences (RAF-indexed):
    • PDB 3GM0
    Domains in SCOPe 2.06: d3gm0a1, d3gm0a2
  • Heterogens: B41, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gm0A (A:)
    dykddddkevqlqesgpslvkpsqtlsltcsvtgdsvtsgywswirqfpgnkldymgyis
    yrgstyynpslksrisitrdtsknqvylqlksvssedtatyycsyfdsddyameywgqgt
    svtvsggggsggggsggggsqivltqspaimsaspgekvtltcsasssvssshlywyqqk
    pgsspklwiystsnlasgvparfsgsgsgtsysltissmeaedaasyfchqwssfpftfg
    sgtkleikraphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gm0A (A:)
    evqlqesgpslvkpsqtlsltcsvtgdsvtsgywswirqfpgnkldymgyisyrgstyyn
    pslksrisitrdtsknqvylqlksvssedtatyycsyfdsddyameywgqgtsvtvsggg
    gsggggsqivltqspaimsaspgekvtltcsasssvssshlywyqqkpgsspklwiysts
    nlasgvparfsgsgsgtsysltissmeaedaasyfchqwssfpftfgsgtkleikra