PDB entry 3glx

View 3glx on RCSB PDB site
Description: Crystal Structure Analysis of the DtxR(E175K) complexed with Ni(II)
Class: Transcription
Keywords: REPRESSOR, REGULATOR, DTXR, HELIX-TURN-HELIX, METAL ION, ACTIVATION, DNA-BINDING, FERROUS IRON, Cytoplasm, Transcription, Transcriptional regulation, transcriptional regulator, Iron, Transcription regulation
Deposited on 2009-03-12, released 2009-06-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.224
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DIP1414, dtxR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33120 (Start-225)
      • engineered (174)
      • variant (213)
    Domains in SCOPe 2.04: d3glxa1, d3glxa2, d3glxa3
  • Heterogens: NI, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3glxA (A:)
    mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvl
    kdvsrspfgnpipgldelgvgnsdaavpgtrvidaatsmprkvrivqineifqvktdqft
    qlldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3glxA (A:)
    dttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslqmt
    ptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvsr
    spfgnpipgldelgvpgtrvidaatsmprkvrivqineifqvktdqftqlldadirvgse
    veivdrdhitlshkdvellddlahtirieel