PDB entry 3gl9

View 3gl9 on RCSB PDB site
Description: The structure of a histidine kinase-response regulator complex sheds light into two-component signaling and reveals a novel cis autophosphorylation mechanism
Class: signaling protein
Keywords: beta-sheet, surrounded by alpha helices, both sides, SIGNALING PROTEIN
Deposited on 2009-03-11, released 2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-27, with a file datestamp of 2009-10-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gl9a_
  • Chain 'B':
    Compound: Response regulator
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gl9b_
  • Chain 'C':
    Compound: Response regulator
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gl9c_
  • Chain 'D':
    Compound: Response regulator
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gl9d_
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gl9A (A:)
    mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
    gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
    ne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gl9A (A:)
    skkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmdg
    ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gl9B (B:)
    mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
    gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
    ne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gl9B (B:)
    skkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmdg
    ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln
    e
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gl9C (C:)
    mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
    gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
    ne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gl9C (C:)
    skkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmdg
    ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gl9D (D:)
    mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
    gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
    ne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gl9D (D:)
    skkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmdg
    ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln