PDB entry 3gkz

View 3gkz on RCSB PDB site
Description: Crystal structures of a therapeutic single chain antibody in complex methamphetamine
Class: immune system
Keywords: Therapeutic antibody, Methamphetamine, amphetamine, MDMA,IgG, IMMUNE SYSTEM
Deposited on 2009-03-11, released 2009-10-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-methamphetamine single chain Fv
    Species: Mus musculus [TaxId:10090]
    Gene: IgG
    Database cross-references and differences (RAF-indexed):
    • PDB 3GKZ
    Domains in SCOPe 2.06: d3gkza1, d3gkza2
  • Heterogens: B40, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gkzA (A:)
    dykddddkevqlqesgpslvkpsqtlsltcsvtgdsvtsgywswirqfpgnkldymgyis
    yrgstyynpslksrisitrdtsknqvylqlksvssedtatyycsyfdsddyameywgqgt
    svtvsggggsggggsggggsqivltqspaimsaspgekvtltcsasssvssshlywyqqk
    pgsspklwiystsnlasgvparfsgsgsgtsysltissmeaedaasyfchqwssfpftfg
    sgtkleikraphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gkzA (A:)
    evqlqesgpslvkpsqtlsltcsvtgdsvtsgywswirqfpgnkldymgyisyrgstyyn
    pslksrisitrdtsknqvylqlksvssedtatyycsyfdsddyameywgqgtsvtvssgg
    ggsqivltqspaimsaspgekvtltcsasssvssshlywyqqkpgsspklwiystsnlas
    gvparfsgsgsgtsysltissmeaedaasyfchqwssfpftfgsgtkleikra