PDB entry 3gkw

View 3gkw on RCSB PDB site
Description: Crystal structure of the Fab fragment of Nimotuzumab. An anti-epidermal growth factor receptor antibody
Class: immune system, antitumor protein
Keywords: Immunoglobulin fold, Displaced strictly conserved TRP 103 following Kabat numbering, IMMUNE SYSTEM, ANTITUMOR PROTEIN
Deposited on 2009-03-11, released 2009-08-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy chain of the antibody Nimotuzumab
    Species: Homo sapiens [TaxId:9606]
    Gene: Immonoglobulin
    Database cross-references and differences (RAF-indexed):
    • PDB 3GKW (Start-221)
  • Chain 'L':
    Compound: Light chain of the antibody Nimotuzumab
    Species: Homo sapiens [TaxId:9606]
    Gene: Immonoglobulin
    Database cross-references and differences (RAF-indexed):
    • PDB 3GKW (0-End)
    Domains in SCOPe 2.04: d3gkwl1, d3gkwl2
  • Heterogens: PEG, 1PE, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >3gkwL (L:)
diqmtqspsslsasvgdrvtitcrssqnivhsngntyldwyqqtpgkapklliykvsnrf
sgvpsrfsgsgsgtdftftisslqpediatyycfqyshvpwtfgqgtklqitrevaapsv
fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
sstltlskadyekhkvyacevthqglsspvtksfnrgec

    Sequence, based on observed residues (ATOM records): (download) 
    >3gkwL (L:)
diqmtqspsslsasvgdrvtitcrssqnivhsngntyldwyqqtpgkapklliykvsnrf
sgvpsrfsgsgsgtdftftisslqpediatyycfqyshvpwtfgqgtklqitrevaapsv
fifppsdeqlksgtasvvcllnnfypreakvqwqsgnsqesvteqdskdstyslsstltl
skadycevthqglsspvtk