PDB entry 3gje

View 3gje on RCSB PDB site
Description: Rational development of high-affinity T-cell receptor-like antibodies
Class: immune system
Keywords: Antibody, pMHC, immune recognition, IMMUNE SYSTEM
Deposited on 2009-03-08, released 2009-04-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.226
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GJE (0-211)
    Domains in SCOPe 2.06: d3gjea1, d3gjea2
  • Chain 'B':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GJE (0-219)
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GJE (0-219)
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GJE (0-211)
    Domains in SCOPe 2.06: d3gjel1, d3gjel2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gjeA (A:)
    qseltqprsvsgspgqsvtisctgtsrdvggynyvswyqqhpgkapkliihdvierssgv
    pdrfsgsksgntasltisglqaedeadyycwsfagsyyvfgtgtdvtvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegntvektvapt
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gjeL (L:)
    qseltqprsvsgspgqsvtisctgtsrdvggynyvswyqqhpgkapkliihdvierssgv
    pdrfsgsksgntasltisglqaedeadyycwsfagsyyvfgtgtdvtvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegntvektvapt