PDB entry 3gj0

View 3gj0 on RCSB PDB site
Description: Crystal structure of human RanGDP
Class: transport protein
Keywords: G Protein, GDP, Acetylation, Cytoplasm, GTP-binding, Host-virus interaction, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Protein transport, Transport, TRANSPORT PROTEIN
Deposited on 2009-03-07, released 2009-08-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.182
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: ARA24, OK/SW-cl.81, RAN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826 (6-End)
      • expression tag (5)
    Domains in SCOPe 2.05: d3gj0a_
  • Chain 'B':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: ARA24, OK/SW-cl.81, RAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3gj0b_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gj0A (A:)
    gphmasaaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtn
    rgpikfnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvceni
    pivlcgnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnle
    fvampalappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gj0A (A:)
    saaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqtt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gj0B (B:)
    gphmasaaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtn
    rgpikfnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvceni
    pivlcgnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnle
    fvampalappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gj0B (B:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    glrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikdrkvka
    ksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevvmdpal
    aaqyehdlevaqt