PDB entry 3giz

View 3giz on RCSB PDB site
Description: Crystal structure of the Fab fragment of anti-CD20 antibody Ofatumumab
Class: immune system
Keywords: CD20, 2F2, Ofatumumab, Hu-MaxCD20, Fab, antibody, fully human antibody, IMMUNE SYSTEM
Deposited on 2009-03-07, released 2009-05-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: Fab fragment of anti-CD20 antibody Ofatumumab, heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 3GIZ (0-221)
• Chain 'L':
  Compound: Fab fragment of anti-CD20 antibody Ofatumumab, light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 3GIZ (0-210)
  Domains in SCOPe 2.04: d3gizl1, d3gizl2
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3gizL (L:)
  eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
  rfsgsgsgtdftltisslepedfavyycqqrsnwpitfgqgtrleikrtvaapsvfifpp
  sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnr