PDB entry 3gi8

View 3gi8 on RCSB PDB site
Description: Crystal Structure of ApcT K158A Transporter Bound to 7F11 Monoclonal Fab Fragment
Class: transport protein
Keywords: membrane protein, transporter, antibody, Cell membrane, Membrane, Transmembrane, TRANSPORT PROTEIN, Structural Genomics, PSI-2, Protein Structure Initiative, New York Consortium on Membrane Protein Structure, NYCOMPS
Deposited on 2009-03-05, released 2009-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.256
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Uncharacterized protein MJ0609
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0609
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58026 (0-434)
      • engineered (157)
  • Chain 'H':
    Compound: 7F11 Anti-ApcT Monoclonal Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GI8 (0-222)
  • Chain 'L':
    Compound: 7F11 Anti-ApcT Monoclonal Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GI8 (0-219)
    Domains in SCOPe 2.07: d3gi8l1, d3gi8l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3gi8L (L:)
divmtqspsslamsvgqkvtlsckssqsllntsnqknylawyqqkpgqspkllvyfastr
esgvpdrfigsgsgtdftltissvqaedlsdffcqqhystpytfgggtkleikradaapt
vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
msstltltkdeyerhnsytceathktstspivksfnrnec