PDB entry 3gg3

View 3gg3 on RCSB PDB site
Description: Crystal Structure of the Bromodomain of Human PCAF
Class: Transferase
Keywords: PCAF, K(lysine) acetyltransferase 2B, KAT2B, GCN5, GCN5L, P, P/CAF, CREBBP-associated factor, p300/CBP-associated factor, SGC, Structural Genomics Consortium, Acyltransferase, Bromodomain, Cell cycle, Host-virus interaction, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Transferase
Deposited on 2009-02-27, released 2009-03-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.209
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase PCAF
    Species: Homo sapiens [TaxId:9606]
    Gene: PCAF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gg3a_
  • Chain 'B':
    Compound: Histone acetyltransferase PCAF
    Species: Homo sapiens [TaxId:9606]
    Gene: PCAF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gg3b_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gg3A (A:)
    smgkekskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlkt
    mserlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gg3A (A:)
    pdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyvs
    kklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gg3B (B:)
    smgkekskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlkt
    mserlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gg3B (B:)
    pdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyvs
    kklfmadlqrvftnckeynppeseyykcanilekfffskikeag