PDB entry 3gfv

View 3gfv on RCSB PDB site
Description: Crystal Structure of Petrobactin-binding Protein YclQ from Bacillu subtilis
Class: transport protein
Keywords: alpha-beta-sandwich, periplasmic binding protein fold (PBP fold), Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Secreted, Transport, unknown function, TRANSPORT PROTEIN
Deposited on 2009-02-27, released 2009-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized ABC transporter solute-binding protein yclQ
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: BSU03830, yclQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P94421 (Start-296)
      • expression tag (297-298)
    Domains in SCOPe 2.07: d3gfva1, d3gfva2
  • Chain 'B':
    Compound: Uncharacterized ABC transporter solute-binding protein yclQ
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: BSU03830, yclQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P94421 (Start-296)
      • expression tag (297)
    Domains in SCOPe 2.07: d3gfvb1, d3gfvb2
  • Heterogens: PO4, ASN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gfvA (A:)
    gnqstsskgsdtkkeqitvkhqldkngtkvpknpkkvvvfdfgsldtldklglddivagl
    pkqvlpkylskfkddkyadvgslkepdfdkvaeldpdliiisarqsesykefskiaptiy
    lgvdtakymesfksdaetigkifdkedkvkdelanidhsiadvkktaeklnknglviman
    dgkisafgpksryglihdvfgvapadqnikasthgqsvsyeyisktnpdylfvidrgtai
    getsstkqvvendyvknvnavknghviyldsatwylsggglesmtqmikevkdglekenl
    yfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gfvA (A:)
    keqitvkhqldkngtkvpknpkkvvvfdfgsldtldklglddivaglpkqvlpkylskfk
    ddkyadvgslkepdfdkvaeldpdliiisarqsesykefskiaptiylgvdtakymesfk
    sdaetigkifdkedkvkdelanidhsiadvkktaeklnknglvimandgkisafgpksry
    glihdvfgvapadqnikasthgqsvsyeyisktnpdylfvidrgtaigetsstkqvvend
    yvknvnavknghviyldsatwylsggglesmtqmikevkdgleken
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gfvB (B:)
    gnqstsskgsdtkkeqitvkhqldkngtkvpknpkkvvvfdfgsldtldklglddivagl
    pkqvlpkylskfkddkyadvgslkepdfdkvaeldpdliiisarqsesykefskiaptiy
    lgvdtakymesfksdaetigkifdkedkvkdelanidhsiadvkktaeklnknglviman
    dgkisafgpksryglihdvfgvapadqnikasthgqsvsyeyisktnpdylfvidrgtai
    getsstkqvvendyvknvnavknghviyldsatwylsggglesmtqmikevkdglekenl
    yfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gfvB (B:)
    keqitvkhqldkngtkvpknpkkvvvfdfgsldtldklglddivaglpkqvlpkylskfk
    ddkyadvgslkepdfdkvaeldpdliiisarqsesykefskiaptiylgvdtakymesfk
    sdaetigkifdkedkvkdelanidhsiadvkktaeklnknglvimandgkisafgpksry
    glihdvfgvapadqnikasthgqsvsyeyisktnpdylfvidrgtaigetsstkqvvend
    yvknvnavknghviyldsatwylsggglesmtqmikevkdgleke