PDB entry 3gft

View 3gft on RCSB PDB site
Description: Human K-Ras (Q61H) in complex with a GTP analogue
Class: signaling protein
Keywords: cancer, small gtpase, mutations, gtp analogue, Structural Genomics Consortium, SGC, Cardiomyopathy, Cell membrane, Deafness, Disease mutation, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Palmitate, Prenylation, Proto-oncogene, SIGNALING PROTEIN
Deposited on 2009-02-27, released 2009-03-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.215
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (18-End)
      • see remark 999 (78)
    Domains in SCOPe 2.06: d3gfta_
  • Chain 'B':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (18-End)
      • expression tag (15-17)
    Domains in SCOPe 2.06: d3gftb1, d3gftb2
  • Chain 'C':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (18-End)
      • expression tag (14-17)
    Domains in SCOPe 2.06: d3gftc1, d3gftc2
  • Chain 'D':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gftd_
  • Chain 'E':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (18-End)
      • expression tag (15-17)
    Domains in SCOPe 2.06: d3gfte1, d3gfte2
  • Chain 'F':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (18-End)
      • expression tag (15-17)
    Domains in SCOPe 2.06: d3gftf1, d3gftf2
  • Heterogens: MG, GNP, UNX, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gftA (A:)
    mhhhhhhssgrenlyfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrk
    qvvidgetclldildtagheeysamrdqymrtgegflcvfainntksfedihhyreqikr
    vkdsedvpmvlvgnkcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvre
    irkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gftA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gftB (B:)
    mhhhhhhssgrenlyfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrk
    qvvidgetclldildtagheeysamrdqymrtgegflcvfainntksfedihhyreqikr
    vkdsedvpmvlvgnkcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvre
    irkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gftB (B:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagsamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlp
    srtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gftC (C:)
    mhhhhhhssgrenlyfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrk
    qvvidgetclldildtagheeysamrdqymrtgegflcvfainntksfedihhyreqikr
    vkdsedvpmvlvgnkcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvre
    irkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gftC (C:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptdsyrkqvvidgetclldildt
    agsamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlps
    rtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gftD (D:)
    mhhhhhhssgrenlyfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrk
    qvvidgetclldildtagheeysamrdqymrtgegflcvfainntksfedihhyreqikr
    vkdsedvpmvlvgnkcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvre
    irkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gftD (D:)
    mteyklvvvgaggvgksaltiqliqnhfvdedsyrkqvvidgetclldildtagmrtgeg
    flcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkqaqdlarsy
    gipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3gftE (E:)
    mhhhhhhssgrenlyfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrk
    qvvidgetclldildtagheeysamrdqymrtgegflcvfainntksfedihhyreqikr
    vkdsedvpmvlvgnkcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvre
    irkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gftE (E:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrt
    vdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3gftF (F:)
    mhhhhhhssgrenlyfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrk
    qvvidgetclldildtagheeysamrdqymrtgegflcvfainntksfedihhyreqikr
    vkdsedvpmvlvgnkcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvre
    irkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gftF (F:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdedsyrkqvvidgetclldildtadqym
    rtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkqaqd
    larsygipfietsaktrqgvddafytlvreirkhk