PDB entry 3gfo

View 3gfo on RCSB PDB site
Description: Structure of cbiO1 from clostridium perfringens: Part of the ABC transporter complex cbiONQ.
Class: ATP binding protein
Keywords: structural genomics, cbiO1, Cobalt import ATP-binding protein cbiO 1, ATP-binding, Cell membrane, Cobalt, Cobalt transport, Hydrolase, Ion transport, Membrane, Nucleotide-binding, Transport, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ATP binding protein
Deposited on 2009-02-27, released 2009-03-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.209
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cobalt import ATP-binding protein cbiO 1
    Species: Clostridium perfringens ATCC 13124 [TaxId:195103]
    Gene: cbiO1, CPF_0188
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3gfoa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gfoA (A:)
    msledyilkveelnynysdgthalkginmnikrgevtailggngvgkstlfqnfngilkp
    ssgrilfdnkpidysrkgimklresigivfqdpdnqlfsasvyqdvsfgavnmklpedei
    rkrvdnalkrtgiehlkdkpthclsfgqkkrvaiagvlvmepkvlildeptagldpmgvs
    eimkllvemqkelgitiiiathdidivplycdnvfvmkegrvilqgnpkevfaekevirk
    vnlrlprighlmeilkekdgfvfdeldeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gfoA (A:)
    edyilkveelnynysdgthalkginmnikrgevtailggngvgkstlfqnfngilkpssg
    rilfdnkpidysrkgimklresigivfqdpdnqlfsasvyqdvsfgavnmklpedeirkr
    vdnalkrtgiehlkdkpthclsfgqkkrvaiagvlvmepkvlildeptagldpmgvseim
    kllvemqkelgitiiiathdidivplycdnvfvmkegrvilqgnpkevfaekevirkvnl
    rlprighlmei