PDB entry 3gd6

View 3gd6 on RCSB PDB site
Description: Crystal structure of divergent enolase from Oceanobacillus iheyensis complexed with phosphate
Class: isomerase, lyase
Keywords: Structural Genomics, NYSGXRC, target 9375a, divergent enolase, Isomerase, LYASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics
Deposited on 2009-02-23, released 2009-03-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-03-03, with a file datestamp of 2009-02-27.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.236
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis HTE831 [TaxId:221109]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gd6a1, d3gd6a2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gd6A (A:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gd6A (A:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlsw