PDB entry 3gcf

View 3gcf on RCSB PDB site
Description: Terminal oxygenase of carbazole 1,9a-dioxygenase from Nocardioides aromaticivorans IC177
Class: oxidoreductase
Keywords: rieske oxygenase, 2fe-2s, dioxygenase, carbazole, electron transfer, oxidoreductase
Deposited on 2009-02-22, released 2009-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcfa1, d3gcfa2
  • Chain 'B':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcfb1, d3gcfb2
  • Chain 'C':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcfc1, d3gcfc2
  • Chain 'D':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcfd1, d3gcfd2
  • Chain 'E':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcfe1, d3gcfe2
  • Chain 'F':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcff1, d3gcff2
  • Chain 'G':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcfg1, d3gcfg2
  • Chain 'H':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcfh1, d3gcfh2
  • Chain 'I':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcfi1, d3gcfi2
  • Chain 'J':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcfj1, d3gcfj2
  • Chain 'K':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcfk1, d3gcfk2
  • Chain 'L':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcfl1, d3gcfl2
  • Chain 'M':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcfm1, d3gcfm2
  • Chain 'N':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcfn1, d3gcfn2
  • Chain 'O':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gcfo1, d3gcfo2
  • Heterogens: FE2, FES, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gcfA (A:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfA (A:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gcfB (B:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfB (B:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gcfC (C:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfC (C:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gcfD (D:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfD (D:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3gcfE (E:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfE (E:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3gcfF (F:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfF (F:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3gcfG (G:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfG (G:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3gcfH (H:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfH (H:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3gcfI (I:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfI (I:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3gcfJ (J:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfJ (J:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3gcfK (K:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfK (K:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3gcfL (L:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfL (L:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3gcfM (M:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfM (M:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3gcfN (N:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfN (N:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3gcfO (O:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfO (O:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra