PDB entry 3gc2

View 3gc2 on RCSB PDB site
Description: 1.85 Angstrom Crystal Structure of O-succinylbenzoate Synthase from Salmonella typhimurium in Complex with Succinic Acid
Class: lyase
Keywords: O-succinylbenzoate synthase, Succinic Acid, idp00994, Lyase, Magnesium, Menaquinone biosynthesis, Metal-binding, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2009-02-21, released 2009-03-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: o-succinylbenzoate synthase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: menC, STM2306
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58486 (3-322)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3gc2a1, d3gc2a2, d3gc2a3
  • Heterogens: SIN, EPE, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gc2A (A:)
    snamrsaqvyrwqipmdagvvlrdrrlktrdglyvclrdgeregwgeisplpgfsqetwe
    eaqtalltwvndwlqgseglpempsvafgascalaeltgvlpeaadyraaplctgdpddl
    vlrladmpgekiakvkvglyeavrdgmvvnllleaipdlhlrldanrawtplkaqqfaky
    vnpdyrariafleepcktrddsrafaretgiaiawdeslreadftfeaeegvravvikpt
    ltgsldkvreqvaaahalgltavisssiesslgltqlariaawltpgtlpgldtlhlmqa
    qqirpwpgsalpclkreelerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gc2A (A:)
    namrsaqvyrwqipmdagvvlrdrrlktrdglyvclrdgeregwgeisplpgfsqetwee
    aqtalltwvndwlqgseglpempsvafgascalaeltgvlpeaadyraaplctgdpddlv
    lrladmpgekiakvkvglyeavrdgmvvnllleaipdlhlrldanrawtplkaqqfakyv
    npdyrariafleepcktrddsrafaretgiaiawdeslreadftfeaeegvravvikptl
    tgsldkvreqvaaahalgltavisssiesslgltqlariaawltpgtlpgldtlhlmqaq
    qirpwpgsalpclkreelerll