PDB entry 3gbq

View 3gbq on RCSB PDB site
Description: solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
Deposited on 1996-12-23, released 1997-09-04
The last revision prior to the SCOP 1.59 freeze date was dated 1997-09-04, with a file datestamp of 1997-09-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d3gbqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gbqA (A:)
    meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemkp