PDB entry 3gbp

View 3gbp on RCSB PDB site
Description: structure of the periplasmic glucose/galactose receptor of salmonella typhimurium
Class: periplasmic binding protein
Keywords: periplasmic binding protein
Deposited on 1990-01-25, released 1991-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.158
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galactose-binding protein
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23905 (Start-306)
      • conflict (151)
    Domains in SCOPe 2.06: d3gbpa_
  • Heterogens: BGC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gbpA (A:)
    adtrigvtiykyddnfmsvvrkaiekdgksapdvqllmndsqndqskqndqidvllakgv
    kalainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgviqg
    dliakhwqanqgwdlnkdgkiqyvllkgepghpdaearttyvvkelndkgiqteqlaldt
    amwdtaqakdkmdawlsgpnankievvianndamamgavealkahnkssipvfgvdalpe
    alalvksgamagtvlndannqakatfdlaknlaegkgaadgtswkienkivrvpyvgvdk
    dnlseft
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gbpA (A:)
    trigvtiykyddnfmsvvrkaiekdgksapdvqllmndsqndqskqndqidvllakgvka
    lainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgviqgdl
    iakhwqanqgwdlnkdgkiqyvllkgepghpdaearttyvvkelndkgiqteqlaldtam
    wdtaqakdkmdawlsgpnankievvianndamamgavealkahnkssipvfgvdalpeal
    alvksgamagtvlndannqakatfdlaknlaegkgaadgtswkienkivrvpyvgvdkdn
    lseft