PDB entry 3gbn

View 3gbn on RCSB PDB site
Description: Crystal Structure of Fab CR6261 in Complex with the 1918 H1N1 influenza virus hemagglutinin
Class: viral protein/immune system
Keywords: hemagglutinin, Fab, neutralizing antibodies, antibody, pandemic flu, Cell membrane, Envelope protein, Fusion protein, Glycoprotein, Lipoprotein, Membrane, Palmitate, Transmembrane, Virion, VIRAL PROTEIN-IMMUNE SYSTEM COMPLEX
Deposited on 2009-02-20, released 2009-03-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Brevig Mission/1/1918(H1N1)) [TaxId:88776]
    Gene: HA, Hemagglutinin (HA)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFX3 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d3gbna1, d3gbna2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Brevig Mission/1/1918(H1N1)) [TaxId:88776]
    Gene: HA, Hemagglutinin (HA)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gbnb_
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GBN (0-End)
  • Chain 'L':
    Compound: Fab Lambda Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GBN
    Domains in SCOPe 2.07: d3gbnl1
  • Heterogens: NAG, EDO, GOL, ETX, CL, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gbnA (A:)
    adpgdticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcn
    iagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvl
    wgvhhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllep
    gdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnih
    pvtigecpkyvrstklrmatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gbnA (A:)
    adpgdticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcn
    iagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvl
    wgvhhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllep
    gdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnih
    pvtigecpkyvrstklrmatglrnipsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gbnB (B:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreeidgvsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gbnB (B:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreei
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3gbnL (L:)
    qsvltqppsvsaapgqkvtiscsgsssnigndyvswyqqlpgtapklliydnnkrpsgip
    drfsgsksgtsatlgitglqtgdeanyycatwdrrptayvvfgggtkltvlgaaagqpka
    apsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnk
    yaassylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gbnL (L:)
    vltqppsvsaapgqkvtiscsgsssnigndyvswyqqlpgtapklliydnnkrpsgipdr
    fsgsksgtsatlgitglqtgdeanyycatwdrrptayvvfgggtkltvleelqankatlv
    clisdfygvetttpskqsnnkyaassylscq