PDB entry 3ga1

View 3ga1 on RCSB PDB site
Description: Crystal Structure of the Human Nac1 POZ Domain
Class: transcription
Keywords: BTB/POZ domain, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation
Deposited on 2009-02-16, released 2009-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleus accumbens-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96RE7
      • engineered (101)
    Domains in SCOPe 2.07: d3ga1a_
  • Chain 'B':
    Compound: Nucleus accumbens-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96RE7 (5-End)
      • engineered (101)
    Domains in SCOPe 2.07: d3ga1b_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ga1A (A:)
    gplgsaqtlqmeipnfgnsileclneqrlqglycdvsvvvkghafkahravlaasssyfr
    dlfnnsrsavvelpaavqpqsfqqilsfcytgrlsmnvgdqdllmytagflqiqeimekg
    tefflkvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ga1A (A:)
    qtlqmeipnfgnsileclneqrlqglycdvsvvvkghafkahravlaasssyfrdlfnns
    rsavvelpaavqpqsfqqilsfcytgrlsmnvgdqdllmytagflqiqeimek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ga1B (B:)
    gplgsaqtlqmeipnfgnsileclneqrlqglycdvsvvvkghafkahravlaasssyfr
    dlfnnsrsavvelpaavqpqsfqqilsfcytgrlsmnvgdqdllmytagflqiqeimekg
    tefflkvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ga1B (B:)
    aqtlqmeipnfgnsileclneqrlqglycdvsvvvkghafkahravlaasssyfrdlfnn
    srsavvelpaavqpqsfqqilsfcytgrlsmnvgdqdllmytagflqiqeimekgteffl
    kv