PDB entry 3g9w

View 3g9w on RCSB PDB site
Description: Crystal Structure of Talin2 F2-F3 in Complex with the Integrin Beta1D Cytoplasmic Tail
Class: cell adhesion
Keywords: protein-protein complex, PH domain superfold, PTB domain, helical bundle, intrinsically unstructured, CELL ADHESION
Deposited on 2009-02-15, released 2009-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.215
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Talin-2
    Species: Mus musculus [TaxId:10090]
    Gene: Tln2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71LX4 (12-222)
      • expression tag (6-11)
    Domains in SCOPe 2.07: d3g9wa1, d3g9wa2, d3g9wa3
  • Chain 'B':
    Compound: Talin-2
    Species: Mus musculus [TaxId:10090]
    Gene: Tln2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g9wb1, d3g9wb2
  • Chain 'C':
    Compound: Integrin beta-1D
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05556 (2-End)
      • expression tag (0-1)
  • Chain 'D':
    Compound: Integrin beta-1D
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05556 (2-End)
      • expression tag (0-1)
  • Heterogens: GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g9wA (A:)
    gidpftgidpftkffysdqnvdsrdpvqlnllyvqarddilngshpvsfekacefggfqa
    qiqfgphvehkhkpgfldlkeflpkeyikqrgaekrifqehkncgemseieakvkyvkla
    rslrtygvsfflvkekmkgknklvprllgitkdsvmrvdektkevlqewplttvkrwaas
    pksftldfgeyqesyysvqttegeqisqliagyidiilkkkqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9wA (A:)
    gidpftkffysdqnvdsrdpvqlnllyvqarddilngshpvsfekacefggfqaqiqfgp
    hvehkhkpgfldlkeflpkeyikqrgaekrifqehkncgemseieakvkyvklarslrty
    gvsfflvkekmkgknklvprllgitkdsvmrvdektkevlqewplttvkrwaaspksftl
    dfgeyqesyysvqttegeqisqliagyidiilkkkqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g9wB (B:)
    gidpftgidpftkffysdqnvdsrdpvqlnllyvqarddilngshpvsfekacefggfqa
    qiqfgphvehkhkpgfldlkeflpkeyikqrgaekrifqehkncgemseieakvkyvkla
    rslrtygvsfflvkekmkgknklvprllgitkdsvmrvdektkevlqewplttvkrwaas
    pksftldfgeyqesyysvqttegeqisqliagyidiilkkkqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9wB (B:)
    nvdsrdpvqlnllyvqarddilngshpvsfekacefggfqaqiqfgphvehkhkpgfldl
    keflpkeyikqrgaekrifqehkncgemseieakvkyvklarslrtygvsfflvkekmkg
    knklvprllgitkdsvmrvdektkevlqewplttvkrwaaspksftldfgeyqesyysvq
    ttegeqisqliagyidiilkkkqs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.