PDB entry 3g9t

View 3g9t on RCSB PDB site
Description: Crystal structure of EstE5, was soaked by p-nitrophenyl butyrate for 5sec
Class: hydrolase
Keywords: HSL, EstE5, esterase, lipase, HYDROLASE
Deposited on 2009-02-14, released 2009-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.195
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Esterase/lipase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: estE5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g9ta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g9tA (A:)
    masmtggqqmgrgmagpeivklkkilrekavppgtevpldvmrkgmekvafkaaddiqve
    qvtvagcaaewvrapgcqagkailylhgggyvmgsinthrsmvgeisrasqaaallldyr
    lapehpfpaavedgvaayrwlldqgfkpqhlsisgdsaggglvlavlvsardqglpmpas
    aipispwadmtctndsfktraeadpmvapgginkmaarylngadakhpyaspnfanlkgl
    ppllihvgrdevllddsikldakakadgvkstleiwddmihvwhafhpmlpegkqaivrv
    gefmreqwaalaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9tA (A:)
    agpeivklkkilrekavppgtevpldvmrkgmekvafkaaddiqveqvtvagcaaewvra
    pgcqagkailylhgggyvmgsinthrsmvgeisrasqaaallldyrlapehpfpaavedg
    vaayrwlldqgfkpqhlsisgdsaggglvlavlvsardqglpmpasaipispwadmtctn
    dsfktraeadpmpgginkmaarylngadakhpyaspnfanlkglppllihvgrdevlldd
    sikldakakadgvkstleiwddmihvwhafhpmlpegkqaivrvgefmreqwaa