PDB entry 3g9q

View 3g9q on RCSB PDB site
Description: Crystal structure of the FhuD fold-family BSU3320, a periplasmic binding protein component of a Fep/Fec-like ferrichrome ABC transporter from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR577A
Class: transport protein
Keywords: alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Cell membrane, Ion transport, Iron, Iron transport, Lipoprotein, Membrane, Palmitate, Transport, TRANSPORT PROTEIN
Deposited on 2009-02-13, released 2009-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrichrome-binding protein
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: BSU33320, fhuD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37580 (Start-270)
      • expression tag (271-272)
    Domains in SCOPe 2.07: d3g9qa1, d3g9qa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g9qA (A:)
    ykaengnvkipkhpkrvvvmadgyygyfktlginvvgapenvfknpyykgktngvenigd
    gtsvekvidlnpdliivwttqgadikklekiaptvavkydkldnieqlkefakmtgtedk
    aekwlakwdkkvaaaktkikkavgdktisimqtngkdiyvfgkdfgrggsiiykdlglqa
    tkltkekaidqgpgytsisleklpdfagdyifagpwqsggddggvfessiwknlnavkng
    hvykmdpigfyftdpislegqlefitesltklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9qA (A:)
    ipkhpkrvvvmadgyygyfktlginvvgapenvfknpyykgktngvenigdgtsvekvid
    lnpdliivwttadikklekiaptvavkydkldnieqlkefakmtgtedkaekwlakwdkk
    vaaaktkikkavgdktisimqtngkdiyvfgkdfgrggsiiykdlglqatkltkekaidq
    gpgytsisleklpdfagdyifagpwqsggvfessiwknlnavknghvykmdpigfyftdp
    islegqlefitesltkle