PDB entry 3g9c

View 3g9c on RCSB PDB site
Description: Crystal structure of the product Bacillus anthracis glmS ribozyme
Class: RNA binding protein/RNA
Keywords: catalytic RNA, Acetylation, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, Ribonucleoprotein, RNA-binding, Spliceosome
Deposited on 2009-02-13, released 2009-11-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.249
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.05: d3g9ca_
  • Chain 'B':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.05: d3g9cb_
  • Chain 'C':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.05: d3g9cc_
  • Chain 'D':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.05: d3g9cd_
  • Chain 'E':
    Compound: RNA (5'-r(*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: RNA (5'-r(*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: RNA (5'-r(*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: RNA (5'-r(*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
    Species: synthetic, synthetic
  • Chain 'P':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Chain 'Q':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Chain 'R':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Chain 'S':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Heterogens: GLP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g9cA (A:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9cA (A:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g9cB (B:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9cB (B:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3g9cC (C:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9cC (C:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3g9cD (D:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9cD (D:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.