PDB entry 3g9c

View 3g9c on RCSB PDB site
Description: Crystal structure of the product Bacillus anthracis glmS ribozyme
Class: RNA binding protein/RNA
Keywords: catalytic RNA, Acetylation, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, Ribonucleoprotein, RNA-binding, Spliceosome, RNA binding protein-RNA complex
Deposited on 2009-02-13, released 2009-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Homo sapiens [TaxId:9606]
  Gene: SNRPA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09012
    • engineered (30)
    • engineered (35)
  Domains in SCOPe 2.08: d3g9ca_
• Chain 'B':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Homo sapiens [TaxId:9606]
  Gene: SNRPA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09012
    • engineered (30)
    • engineered (35)
  Domains in SCOPe 2.08: d3g9cb_
• Chain 'C':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Homo sapiens [TaxId:9606]
  Gene: SNRPA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09012
    • engineered (30)
    • engineered (35)
  Domains in SCOPe 2.08: d3g9cc_
• Chain 'D':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Homo sapiens [TaxId:9606]
  Gene: SNRPA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09012
    • engineered (30)
    • engineered (35)
  Domains in SCOPe 2.08: d3g9cd_
• Chain 'E':
  Compound: RNA (5'-r(*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
  Species: syntetic construct, synthetic [TaxId:32630]
  
• Chain 'F':
  Compound: RNA (5'-r(*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
  Species: syntetic construct, synthetic [TaxId:32630]
  
• Chain 'G':
  Compound: RNA (5'-r(*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
  Species: syntetic construct, synthetic [TaxId:32630]
  
• Chain 'H':
  Compound: RNA (5'-r(*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
  Species: syntetic construct, synthetic [TaxId:32630]
  
• Chain 'P':
  Compound: glms ribozyme
  Species: syntetic construct, synthetic [TaxId:32630]
  
• Chain 'Q':
  Compound: glms ribozyme
  Species: syntetic construct, synthetic [TaxId:32630]
  
• Chain 'R':
  Compound: glms ribozyme
  Species: syntetic construct, synthetic [TaxId:32630]
  
• Chain 'S':
  Compound: glms ribozyme
  Species: syntetic construct, synthetic [TaxId:32630]
  
• Heterogens: GLP, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3g9cA (A:)
  mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
  evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3g9cA (A:)
  rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
  nalrsmqgfpfydkpmriqyaktdsdiiak
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3g9cB (B:)
  mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
  evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3g9cB (B:)
  rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
  nalrsmqgfpfydkpmriqyaktdsdiiak
  

  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >3g9cC (C:)
  mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
  evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3g9cC (C:)
  rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
  nalrsmqgfpfydkpmriqyaktdsdiiak
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >3g9cD (D:)
  mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
  evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3g9cD (D:)
  rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
  nalrsmqgfpfydkpmriqyaktdsdiiak
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.