PDB entry 3g9a

View 3g9a on RCSB PDB site
Description: Green fluorescent protein bound to minimizer nanobody
Class: fluorescent protein/immune system
Keywords: Antibody Complex, Chromophore, Luminescence, Photoprotein, FLUORESCENT PROTEIN-IMMUNE SYSTEM COMPLEX, NANOBODY
Deposited on 2009-02-13, released 2009-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.162
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • engineered (1)
      • engineered (79)
      • engineered (98)
      • engineered (152)
      • engineered (162)
    Domains in SCOPe 2.07: d3g9aa_
  • Chain 'B':
    Compound: Minimizer
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 3G9A
    Domains in SCOPe 2.07: d3g9ab1, d3g9ab2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g9aA (A:)
    mgkgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfsygvqcfsrypdhmkrhdffksampegyvqertisfkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9aA (A:)
    gkgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
    ttfsygvqcfsrypdhmkrhdffksampegyvqertisfkddgnyktraevkfegdtlvn
    rielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladh
    yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g9aB (B:)
    madvqlqesgggsvqaggslrlscaasgdtfssysmawfrqapgkecelvsnilrdgttt
    yagsvkgrftisrddakntvylqmvnlksedtaryycaadsgtqlgyvgavglscldyvm
    dywgkgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9aB (B:)
    vqlqesgggsvqaggslrlscaasgdtfssysmawfrqapgkecelvsnilrdgtttyag
    svkgrftisrddakntvylqmvnlksedtaryycaadsgtqlgyvgavglscldyvmdyw
    gkgtqvtvs