PDB entry 3g8o

View 3g8o on RCSB PDB site
Description: Progesterone Receptor with bound Pyrrolidine 1
Class: transcription
Keywords: Progesterone Receptor, Steroid Hormone Receptor, Nuclear Receptor, PR, progesterone, alpha helical sandwich, DNA-binding, Lipid-binding, Metal-binding, Nucleus, Phosphoprotein, Receptor, Steroid-binding, Transcription, Transcription regulation, Zinc-finger
Deposited on 2009-02-12, released 2010-02-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C3, PGR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3g8oa_
  • Chain 'B':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C3, PGR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3g8ob_
  • Heterogens: 30X, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g8oA (A:)
    gsftfspgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvv
    kwskslpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmk
    essfyslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyir
    elikaiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemms
    eviaaqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g8oA (A:)
    qlipplinllmsiepdviyaghdntkdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
    vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
    gmvkpllfhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g8oB (B:)
    gsftfspgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvv
    kwskslpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmk
    essfyslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyir
    elikaiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemms
    eviaaqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g8oB (B:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
    vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
    gmvkpllfhk