PDB entry 3g84

View 3g84 on RCSB PDB site
Description: Crystal structure of the trimeric neck and carbohydrate recognition domain of R343V mutant of human surfactant protein D in complex with alpha 1,2 dimannose.
Class: sugar binding protein
Keywords: SURFACTANT PROTEIN, CARBOHYDRATE RECOGNITION DOMAIN, TRIMERIC, Collagen, Extracellular matrix, Gaseous exchange, Glycoprotein, Hydroxylation, Lectin, Secreted, Surface film, SUGAR BINDING PROTEIN
Deposited on 2009-02-11, released 2009-03-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD, PSPD, SFTP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35247 (Start-159)
      • engineered (147)
    Domains in SCOPe 2.07: d3g84a1, d3g84a2
  • Chain 'B':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD, PSPD, SFTP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35247 (Start-159)
      • engineered (147)
    Domains in SCOPe 2.07: d3g84b1, d3g84b2
  • Chain 'C':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD, PSPD, SFTP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35247 (Start-159)
      • engineered (147)
    Domains in SCOPe 2.07: d3g84c1, d3g84c2
  • Heterogens: CA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g84A (A:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndvacgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g84A (A:)
    aslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqa
    ggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnd
    dggsedcveiftngkwndvacgekrlvvcef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g84B (B:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndvacgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g84B (B:)
    aslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqa
    ggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnd
    dggsedcveiftngkwndvacgekrlvvcef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3g84C (C:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndvacgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g84C (C:)
    aslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqa
    ggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnd
    dggsedcveiftngkwndvacgekrlvvcef