PDB entry 3g81

View 3g81 on RCSB PDB site
Description: Crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein D in complex with alpha methyl mannoside
Class: sugar binding protein
Keywords: SURFACTANT PROTEIN, CARBOHYDRATE RECOGNITION DOMAIN, Collagen, Extracellular matrix, Gaseous exchange, Glycoprotein, Hydroxylation, Lectin, Secreted, Surface film, SUGAR BINDING PROTEIN
Deposited on 2009-02-11, released 2009-03-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD, PSPD, SFTP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3g81a1, d3g81a2
  • Chain 'B':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD, PSPD, SFTP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3g81b1, d3g81b2
  • Chain 'C':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD, PSPD, SFTP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3g81c1, d3g81c2
  • Heterogens: CA, MMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g81A (A:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g81A (A:)
    aslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqa
    ggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnd
    dggsedcveiftngkwndracgekrlvvcef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g81B (B:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g81B (B:)
    aslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqa
    ggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnd
    dggsedcveiftngkwndracgekrlvvcef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3g81C (C:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g81C (C:)
    slrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqag
    gqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepndd
    ggsedcveiftngkwndracgekrlvvcef